Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARNTL Rabbit Polyclonal Antibody (FITC)

ARNTL Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ar, MO, Bma, MOP3, Arnt3, Bmal1, bHLHe, BMAL1b, bHLHe5, bmal1b'

UniProt

Q68HB9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse ARNTL

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SGVDCNRKRKGSATDYQLDDFAFEESMDTDKDDPHGRLEYAEHQGRIKNA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

AAU00990

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Guanylate Cyclase Activator 2A (GUCA2A) ELISA Kit
RD-GUCA2A-Hu-01 96 Tests

Human Guanylate Cyclase Activator 2A (GUCA2A) ELISA Kit

Sign In for Pricing
View Details
Human Guanylate Cyclase Activator 2A (GUCA2A) ELISA Kit
RD-GUCA2A-Hu-02 48 Tests

Human Guanylate Cyclase Activator 2A (GUCA2A) ELISA Kit

Sign In for Pricing
View Details
Electric bed BHBD-401
BHBD-401 1 Unit

Electric bed BHBD-401

Sign In for Pricing
View Details
Uncoated Mouse FETUA (Fetuin A) ELISA Kit
E-UNEL-M0144-01 5x 96 Tests

Uncoated Mouse FETUA (Fetuin A) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse FETUA (Fetuin A) ELISA Kit
E-UNEL-M0144-02 15x 96 Tests

Uncoated Mouse FETUA (Fetuin A) ELISA Kit

Sign In for Pricing
View Details
Tyrosinase (Melanoma Marker) (rOCA1/812), CF647 conjugate, 0.1mg/mL
BNC472215-100 1x 100 µL

Tyrosinase (Melanoma Marker) (rOCA1/812), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details