Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARNTL Rabbit Polyclonal Antibody (HRP)

ARNTL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ar, MO, Bma, MOP3, Arnt3, Bmal1, bHLHe, BMAL1b, bHLHe5, bmal1b'

UniProt

Q68HB9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse ARNTL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGVDCNRKRKGSATDYQLDDFAFEESMDTDKDDPHGRLEYAEHQGRIKNA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

AAU00990

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PYK2 (Ab-579) Antibody
8B8260-AAT 50 µg

PYK2 (Ab-579) Antibody

Sign In for Pricing
View Details
Tris(2-ethylhexyl) Phosphate
TRC-T884650-10G 10 g

Tris(2-ethylhexyl) Phosphate

Sign In for Pricing
View Details
Air Shower BASB-103
BASB-103 1 Unit

Air Shower BASB-103

Sign In for Pricing
View Details
CCDC105 Human qPCR Primer Pair (NM_173482)
HP218306 200 Reactions

CCDC105 Human qPCR Primer Pair (NM_173482)

Sign In for Pricing
View Details
FOG1 (ZFPM1) Rabbit Polyclonal Antibody
TA383485 100 µL

FOG1 (ZFPM1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant HspB8 Antibody
RC-15247-01 50 μL

Recombinant HspB8 Antibody

Sign In for Pricing
View Details