Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARNTL Rabbit Polyclonal Antibody (HRP)

ARNTL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ar, MO, Bma, MOP3, Arnt3, Bmal1, bHLHe, BMAL1b, bHLHe5, bmal1b'

UniProt

Q68HB9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse ARNTL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGVDCNRKRKGSATDYQLDDFAFEESMDTDKDDPHGRLEYAEHQGRIKNA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

AAU00990

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMYD1 Human Gene Knockout Kit (CRISPR)
KN421269 1 Kit

SMYD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Heptanoic Anhydride
TRC-H252790-25G 25 g

Heptanoic Anhydride

Sign In for Pricing
View Details
GLT8D1 (NM_001278281) Human Tagged ORF Clone
RG237791 10 µg

GLT8D1 (NM_001278281) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human A2LD1 (GGACT) activation kit by CRISPRa
GA113918 1 Kit

Human A2LD1 (GGACT) activation kit by CRISPRa

Sign In for Pricing
View Details
Ɑ-Butyric Acid NHS Ester-ω-Pyridyldithiopropanamido PEG
133000-44-35.1G 1 g

Ɑ-Butyric Acid NHS Ester-ω-Pyridyldithiopropanamido PEG

Sign In for Pricing
View Details
Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3293), CF740 conjugate, 0.1mg/mL
BNC743293-100 1x 100 µL

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3293), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details