Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bapx1 Rabbit Polyclonal Antibody (FITC)

Bapx1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Bap, Bapx1, NKX3.2, Nkx-3., Nkx-3.2

UniProt

P97503

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse Bapx1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_031550

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Potassium Thiocyanate
TRC-P698520-250G 250 g

Potassium Thiocyanate

Sign In for Pricing
View Details
UFC1 sgRNA CRISPR Lentivector (Human) (Target 2)
K2582103 1.0 µg DNA

UFC1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal Sars Envelope Protein Antibody [Alexa Fluor 350]
NBP2-41062AF350 0.1 mL

Rabbit Polyclonal Sars Envelope Protein Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Mouse Monoclonal Thymidylate Synthase Antibody (TMS715) [HRP]
NBP2-34725H 0.1 mL

Mouse Monoclonal Thymidylate Synthase Antibody (TMS715) [HRP]

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
BNC471037-100 1x 100 µL

CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-human CD2 Monoclonal Antibody FITC Conjugated, Flow Validated
FC00570-FITC-01 100 Tests

Anti-human CD2 Monoclonal Antibody FITC Conjugated, Flow Validated

Sign In for Pricing
View Details