Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIITA Rabbit Polyclonal Antibody (HRP)

CIITA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C2t, C2ta, Gm9475, Mhc2ta, EG669998

UniProt

Q3U2P0

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse C2TA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MALWESLQQQGEAQLLQAAEEKFTIEPFKAKSPKDVEDLDRLVQTQRLRN

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

119kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_031601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Monoclonal Antibody to Free+Bound Kappa Light Chain,  40nm
GM-101-40 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Free+Bound Kappa Light Chain, 40nm

Sign In for Pricing
View Details
Recombinant LHX2 Antibody
RC-15022-01 50 μL

Recombinant LHX2 Antibody

Sign In for Pricing
View Details
Recombinant LHX2 Antibody
RC-15022-02 100 µL

Recombinant LHX2 Antibody

Sign In for Pricing
View Details
Recombinant LHX2 Antibody
RC-15022-03 1 mL

Recombinant LHX2 Antibody

Sign In for Pricing
View Details
PDK2 Recombinant Rabbit Monoclonal Antibody [JB66-93]
ET7107-46 100 µL

PDK2 Recombinant Rabbit Monoclonal Antibody [JB66-93]

Sign In for Pricing
View Details
CD5 (C5/473), CF647 conjugate, 0.1mg/mL
BNC470473-500 1x 500 µL

CD5 (C5/473), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details