Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdx4 Rabbit Polyclonal Antibody (HRP)

Cdx4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cdx3, Cdx-3, Cdx-4

UniProt

Q07424

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENTGGSVQSDSGS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_031700

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF2H4 Recombinant Protein (Mouse)
RP140363 100 µg

GTF2H4 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Angiopoietin Like Protein 4 (ANGPTL4)
MBS2050600-01 0.1 mL

HRP-Linked Polyclonal Antibody to Angiopoietin Like Protein 4 (ANGPTL4)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Angiopoietin Like Protein 4 (ANGPTL4)
MBS2050600-02 0.2 mL

HRP-Linked Polyclonal Antibody to Angiopoietin Like Protein 4 (ANGPTL4)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Angiopoietin Like Protein 4 (ANGPTL4)
MBS2050600-03 0.5 mL

HRP-Linked Polyclonal Antibody to Angiopoietin Like Protein 4 (ANGPTL4)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Angiopoietin Like Protein 4 (ANGPTL4)
MBS2050600-04 1 mL

HRP-Linked Polyclonal Antibody to Angiopoietin Like Protein 4 (ANGPTL4)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Angiopoietin Like Protein 4 (ANGPTL4)
MBS2050600-05 5 mL

HRP-Linked Polyclonal Antibody to Angiopoietin Like Protein 4 (ANGPTL4)

Sign In for Pricing
View Details