Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLX4 Rabbit Polyclonal Antibody (HRP)

DLX4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Dlx, Dlx-, Dlx7, Dlx-4

UniProt

P70436

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse DLX4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YSHPGPATPGDSYLPRQQQLVAPSQPFHRPAEHPQELEAESEKLALSLVP

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_031893

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM19 (NM_001146699) Human Over-expression Lysate
LC432073 20 µg

RBM19 (NM_001146699) Human Over-expression Lysate

Sign In for Pricing
View Details
PPME1 Human Gene Knockout Kit (CRISPR)
KN400009 1 Kit

PPME1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biotin Conjugated Griffonia simplicifolia Lectin -GS-II-
BA-2402-2 1 mg

Biotin Conjugated Griffonia simplicifolia Lectin -GS-II-

Sign In for Pricing
View Details
Frozen Tissue Sections, Pancreas
CS623370 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details
Recombinant Human IFNA2 Protein (Trx Tag)
PDEH100540-01 20 µg

Recombinant Human IFNA2 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human IFNA2 Protein (Trx Tag)
PDEH100540-02 100 µg

Recombinant Human IFNA2 Protein (Trx Tag)

Sign In for Pricing
View Details