Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLX4 Rabbit Polyclonal Antibody (Biotin)

DLX4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Dlx, Dlx-, Dlx7, Dlx-4

UniProt

P70436

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse DLX4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YSHPGPATPGDSYLPRQQQLVAPSQPFHRPAEHPQELEAESEKLALSLVP

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_031893

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF3C5, ID (GTF3C5, General transcription factor 3C polypeptide 5, TF3C-epsilon, Transcription factor IIIC 63kD subunit, Transcription factor IIIC subunit epsilon) (PE)
MBS6304975-01 0.2 mL

GTF3C5, ID (GTF3C5, General transcription factor 3C polypeptide 5, TF3C-epsilon, Transcription factor IIIC 63kD subunit, Transcription factor IIIC subunit epsilon) (PE)

Sign In for Pricing
View Details
GTF3C5, ID (GTF3C5, General transcription factor 3C polypeptide 5, TF3C-epsilon, Transcription factor IIIC 63kD subunit, Transcription factor IIIC subunit epsilon) (PE)
MBS6304975-02 5x 0.2 mL

GTF3C5, ID (GTF3C5, General transcription factor 3C polypeptide 5, TF3C-epsilon, Transcription factor IIIC 63kD subunit, Transcription factor IIIC subunit epsilon) (PE)

Sign In for Pricing
View Details
Membrane-spanning 4-domains subfamily A member 6E (MS4A6E) Human ELISA Kit
E9399 96 Tests

Membrane-spanning 4-domains subfamily A member 6E (MS4A6E) Human ELISA Kit

Sign In for Pricing
View Details
Human Calreticulin (CRT) ELISA Kit
MBS2703355-01 24 Strip Well

Human Calreticulin (CRT) ELISA Kit

Sign In for Pricing
View Details
Human Calreticulin (CRT) ELISA Kit
MBS2703355-02 48 Well

Human Calreticulin (CRT) ELISA Kit

Sign In for Pricing
View Details
Human Calreticulin (CRT) ELISA Kit
MBS2703355-03 96 Well

Human Calreticulin (CRT) ELISA Kit

Sign In for Pricing
View Details