Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELF1 Rabbit Polyclonal Antibody (Biotin)

ELF1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P70, Elf-, Sts1, Elf-1, mElf-1

UniProt

Q60775

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse ELF1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DDIVAPITHVSVTLDGIPEVMETQQVQETNADSPGASSPEQRKRKKGRKT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_031946

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIRE (Autoimmune Regulator, Autoimmune Polyendocrinopathy Candidiasis Ectodermal Dystrophy Protein Homolog, APECED Protein Homolog)
A1059-88G 100 µg

AIRE (Autoimmune Regulator, Autoimmune Polyendocrinopathy Candidiasis Ectodermal Dystrophy Protein Homolog, APECED Protein Homolog)

Sign In for Pricing
View Details
Hamster AF4/FMR2 Family, Member 1 ELISA Kit
MBS058928-01 48 Well

Hamster AF4/FMR2 Family, Member 1 ELISA Kit

Sign In for Pricing
View Details
Hamster AF4/FMR2 Family, Member 1 ELISA Kit
MBS058928-02 96 Well

Hamster AF4/FMR2 Family, Member 1 ELISA Kit

Sign In for Pricing
View Details
Hamster AF4/FMR2 Family, Member 1 ELISA Kit
MBS058928-03 5x 96 Well

Hamster AF4/FMR2 Family, Member 1 ELISA Kit

Sign In for Pricing
View Details
Hamster AF4/FMR2 Family, Member 1 ELISA Kit
MBS058928-04 10x 96 Well

Hamster AF4/FMR2 Family, Member 1 ELISA Kit

Sign In for Pricing
View Details
GpsA Antibody
orb815819 2 mg

GpsA Antibody

Sign In for Pricing
View Details