Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESX1 Rabbit Polyclonal Antibody (HRP)

ESX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sp, Spx1

UniProt

O54817

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse ESX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MESHKKCPCCYCTDLKTFVGAVKEETLQDPQPSLSSTLLEGADYQENAES

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse

Tested Applications

WB

NCBI Accession Number

NP_031983

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/1671), CF568 conjugate, 0.1mg/mL
BNC681671-500 1x 500 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/1671), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
D-Mannose-6-phosphate Sodium Salt
TRC-M185003-50MG 50 mg

D-Mannose-6-phosphate Sodium Salt

Sign In for Pricing
View Details
E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/3256), CF405S conjugate, 0.1mg/mL
BNC043256-100 1x 100 µL

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/3256), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human CRTAM Protein (Fc Tag)
PDMH100279-01 20 µg

Recombinant Human CRTAM Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CRTAM Protein (Fc Tag)
PDMH100279-02 100 µg

Recombinant Human CRTAM Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CRTAM Protein (Fc Tag)
PDMH100279-03 500 µg

Recombinant Human CRTAM Protein (Fc Tag)

Sign In for Pricing
View Details