Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GATA5 Rabbit Polyclonal Antibody (HRP)

GATA5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P97489

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse GATA5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SPTLLNSESSATTLKAESSLASPVCAGPTITSQASSPADESLASSHLEFK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_032119

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANGE 790FLI -Shelf 4 level for 2 F safety cabinet
R2FLI each

RANGE 790FLI -Shelf 4 level for 2 F safety cabinet

Sign In for Pricing
View Details
Mxd4 Mouse qPCR Primer Pair (NM_010753)
MP207911 200 Reactions

Mxd4 Mouse qPCR Primer Pair (NM_010753)

Sign In for Pricing
View Details
Recombinant Shewanella sp. Prolipoprotein diacylglyceryl transferase (lgt)
MBS7018728-01 0.02 mg

Recombinant Shewanella sp. Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details
Recombinant Shewanella sp. Prolipoprotein diacylglyceryl transferase (lgt)
MBS7018728-02 0.1 mg

Recombinant Shewanella sp. Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details
Recombinant Shewanella sp. Prolipoprotein diacylglyceryl transferase (lgt)
MBS7018728-03 5x 0.1 mg

Recombinant Shewanella sp. Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details
Mnk1 (phospho Thr250) Polyclonal Antibody
MBS8585911-01 0.1 mg

Mnk1 (phospho Thr250) Polyclonal Antibody

Sign In for Pricing
View Details