Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gcm1 Rabbit Polyclonal Antibody (Biotin)

Gcm1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GCM, gli, GCMa, glide, Gcm1-r, Gcm-rs2, Gcm1-rs1

UniProt

P70348

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse Gcm1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KEILSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032129

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Vasp Pre-designed siRNA Set B
SI115840B 1 Each

Mouse Vasp Pre-designed siRNA Set B

Sign In for Pricing
View Details
ACH1 Antibody
orb844053 2 mg

ACH1 Antibody

Sign In for Pricing
View Details
Gimap7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7508506 1.0 µg DNA

Gimap7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Amphoterin-Induced Protein 1 (AMIGO-1) Antibody (APC)
abx442727 100 µg

Amphoterin-Induced Protein 1 (AMIGO-1) Antibody (APC)

Sign In for Pricing
View Details
Lentiviral mouse Epha4 shRNA (UAS) - Lentiviral mouse Epha4 shRNA (UAS, iRFP) (100)
GTR15250335 1 Vial

Lentiviral mouse Epha4 shRNA (UAS) - Lentiviral mouse Epha4 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
MRPL12 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
30441111 3x 1.0 µg

MRPL12 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details