Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxq1 Rabbit Polyclonal Antibody (HRP)

Foxq1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sa, Hfh1, HFH-1, Hfh1l

UniProt

Q9JJ18

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Foxq1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ADGVFRRRRKRLSHRTTVSASGLRPEEAPPGPAGTPQPAPAARSSPIARS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_032265

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

C5a/C5a des-Arg, Human, mAb 2952
MBS584173-01 0.1 mg

C5a/C5a des-Arg, Human, mAb 2952

Sign In for Pricing
View Details
C5a/C5a des-Arg, Human, mAb 2952
MBS584173-02 5x 0.1 mg

C5a/C5a des-Arg, Human, mAb 2952

Sign In for Pricing
View Details
TCF2 (HNF1 Homeobox B, FJHN, HNF1beta, HNF2, HPC11, LF-B3, LFB3, MODY5, TCF2, VHNF1) (MaxLight 490)
MBS6208905-01 0.1 mL

TCF2 (HNF1 Homeobox B, FJHN, HNF1beta, HNF2, HPC11, LF-B3, LFB3, MODY5, TCF2, VHNF1) (MaxLight 490)

Sign In for Pricing
View Details
TCF2 (HNF1 Homeobox B, FJHN, HNF1beta, HNF2, HPC11, LF-B3, LFB3, MODY5, TCF2, VHNF1) (MaxLight 490)
MBS6208905-02 5x 0.1 mL

TCF2 (HNF1 Homeobox B, FJHN, HNF1beta, HNF2, HPC11, LF-B3, LFB3, MODY5, TCF2, VHNF1) (MaxLight 490)

Sign In for Pricing
View Details
GZMB Antibody, Biotin conjugated
CSB-PA010082LD01HU-01 50 µg

GZMB Antibody, Biotin conjugated

Sign In for Pricing
View Details
GZMB Antibody, Biotin conjugated
CSB-PA010082LD01HU-02 100 µg

GZMB Antibody, Biotin conjugated

Sign In for Pricing
View Details