Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxj1 Rabbit Polyclonal Antibody (FITC)

Foxj1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Hfh4, HFH-4, FKHL-1, FKHL-13

UniProt

Q3US42

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Foxj1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HPAFARQASQEPSAAPWGGPLTVNREAQQLLQEFEEATGEGGWGTGEGRL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032266

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neutravidin Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS
MGW21F-NA/W 10x 96 Well Plates

Neutravidin Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS

Sign In for Pricing
View Details
MIR302f Human qPCR Primer Pair (MI0006418)
HP300293 200 Reactions

MIR302f Human qPCR Primer Pair (MI0006418)

Sign In for Pricing
View Details
Recombinant Human HPRG/HRG Protein (His Tag)
PKSH031403 100 µg

Recombinant Human HPRG/HRG Protein (His Tag)

Sign In for Pricing
View Details
Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker), 0.2mg/mL
BNUB1665-100 1x 100 µL

Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker), 0.2mg/mL

Sign In for Pricing
View Details
TM4SF19 (NM_138461) Human Over-expression Lysate
LC403356 20 µg

TM4SF19 (NM_138461) Human Over-expression Lysate

Sign In for Pricing
View Details
Butyl Palmitate
TRC-B113290-1G 1 g

Butyl Palmitate

Sign In for Pricing
View Details