Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxj1 Rabbit Polyclonal Antibody (HRP)

Foxj1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hfh4, HFH-4, FKHL-1, FKHL-13

UniProt

Q3US42

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Foxj1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HPAFARQASQEPSAAPWGGPLTVNREAQQLLQEFEEATGEGGWGTGEGRL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032266

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Heme A synthase (ctaA)
MBS7013146-01 0.02 mg

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Heme A synthase (ctaA)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus Heme A synthase (ctaA)
MBS7013146-02 0.1 mg

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Heme A synthase (ctaA)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus Heme A synthase (ctaA)
MBS7013146-03 5x 0.1 mg

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Heme A synthase (ctaA)

Sign In for Pricing
View Details
JRKL, CT (JRKL, Jerky protein homolog-like, Human homolog of mouse jerky gene protein) (Azide free) (HRP)
MBS6311811-01 0.2 mL

JRKL, CT (JRKL, Jerky protein homolog-like, Human homolog of mouse jerky gene protein) (Azide free) (HRP)

Sign In for Pricing
View Details
JRKL, CT (JRKL, Jerky protein homolog-like, Human homolog of mouse jerky gene protein) (Azide free) (HRP)
MBS6311811-02 5x 0.2 mL

JRKL, CT (JRKL, Jerky protein homolog-like, Human homolog of mouse jerky gene protein) (Azide free) (HRP)

Sign In for Pricing
View Details
Cbx5, CT (Cbx5, Hp1a, Chromobox protein homolog 5, Heterochromatin protein 1 homolog alpha) (MaxLight 550)
MBS6281229-01 0.1 mL

Cbx5, CT (Cbx5, Hp1a, Chromobox protein homolog 5, Heterochromatin protein 1 homolog alpha) (MaxLight 550)

Sign In for Pricing
View Details