Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXD1 Rabbit Polyclonal Antibody (Biotin)

FOXD1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BF-2, FREA, Hfh10, FREAC4, Hfhbf2, AI385632

UniProt

Q61345

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse FOXD1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TGAGTGGGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISSRFP

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_032268

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 568 Anti-human CD340 Antibody *24D2*
134000B0-AAT 100 Tests

IFluor® 568 Anti-human CD340 Antibody *24D2*

Sign In for Pricing
View Details
Anti-HES6 Rabbit pAb
GB112249 100 μL

Anti-HES6 Rabbit pAb

Sign In for Pricing
View Details
Ephrin A4 (EFNA4) (MaxLight 750)
MBS6474254-01 0.1 mL

Ephrin A4 (EFNA4) (MaxLight 750)

Sign In for Pricing
View Details
Ephrin A4 (EFNA4) (MaxLight 750)
MBS6474254-02 5x 0.1 mL

Ephrin A4 (EFNA4) (MaxLight 750)

Sign In for Pricing
View Details
DNA Polymerase lambda Antibody, AbBy Fluor™ 594 Conjugated
bs-13020R-BF594 100 µL

DNA Polymerase lambda Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Human HBZ/Hemoglobin subunit zeta ELISA Kit
MBS2907115-01 48 Well

Human HBZ/Hemoglobin subunit zeta ELISA Kit

Sign In for Pricing
View Details