Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BST2, Human (HEK293, His)

BST2 Protein, Human (HEK293, His) is a recombinant human bone marrow stromal antigen 2 produced in HEK293 cells. Bone marrow stromal antigen 2 (BST-2; also known as tetherin or CD317) is an IFN-inducible gene that functions to block the release of a range of nascent enveloped virions from infected host cells[1].

Product Specifications

Product Name Alternative

BST2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bst2-protein-human-hek293-his.html

Purity

95.43

Smiles

NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSHHHHHH

Molecular Formula

684 (Gene_ID) Q10589 (N49-S161) (Accession)

Molecular Weight

20-30 kDa

References & Citations

[1]Mahauad-Fernandez WD, et al. Critical role for bone marrow stromal antigen 2 in acute Chikungunya virus infection. J Gen Virol. 2014;95 (Pt 11) :2450-2461.|[2]Tiwari R, et al. Beyond Tethering the Viral Particles: Immunomodulatory Functions of Tetherin (BST-2) . DNA Cell Biol. 2019;38 (11) :1170-1177.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMIGD1 activation kit by CRISPRa
GA117948 1 Kit

Human TMIGD1 activation kit by CRISPRa

Sign In for Pricing
View Details
GSK3 beta Recombinant Rabbit Monoclonal Antibody [SY28-03]
ET1607-71 100 µL

GSK3 beta Recombinant Rabbit Monoclonal Antibody [SY28-03]

Sign In for Pricing
View Details
Recombinant MCAM Antibody
RC-4027-01 50 μL

Recombinant MCAM Antibody

Sign In for Pricing
View Details
Recombinant MCAM Antibody
RC-4027-02 100 µL

Recombinant MCAM Antibody

Sign In for Pricing
View Details
Recombinant MCAM Antibody
RC-4027-03 1 mL

Recombinant MCAM Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS700115 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details