Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BST2, Human (HEK293, His)

BST2 Protein, Human (HEK293, His) is a recombinant human bone marrow stromal antigen 2 produced in HEK293 cells. Bone marrow stromal antigen 2 (BST-2; also known as tetherin or CD317) is an IFN-inducible gene that functions to block the release of a range of nascent enveloped virions from infected host cells[1].

Product Specifications

Product Name Alternative

BST2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bst2-protein-human-hek293-his.html

Purity

95.43

Smiles

NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSHHHHHH

Molecular Formula

684 (Gene_ID) Q10589 (N49-S161) (Accession)

Molecular Weight

20-30 kDa

References & Citations

[1]Mahauad-Fernandez WD, et al. Critical role for bone marrow stromal antigen 2 in acute Chikungunya virus infection. J Gen Virol. 2014;95 (Pt 11) :2450-2461.|[2]Tiwari R, et al. Beyond Tethering the Viral Particles: Immunomodulatory Functions of Tetherin (BST-2) . DNA Cell Biol. 2019;38 (11) :1170-1177.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Bovine IgG,  15nm
GAF-511-15 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Bovine IgG, 15nm

Sign In for Pricing
View Details
Crocein Orange G
TRC-C794955-500MG 500 mg

Crocein Orange G

Sign In for Pricing
View Details
Nicotinamide 1,N6-Ethenoadenine Dinucleotide
TRC-N407735-5MG 5 mg

Nicotinamide 1,N6-Ethenoadenine Dinucleotide

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Human a-1-Glycoprotein
AA-2114-1 1 mL

Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Human a-1-Glycoprotein

Sign In for Pricing
View Details
Ubn2 Mouse Gene Knockout Kit (CRISPR)
KN518611 1 Kit

Ubn2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VGLL1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A9]
TA810645BM 100 µL

VGLL1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A9]

Sign In for Pricing
View Details