Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BST2, Human (HEK293, His)

BST2 Protein, Human (HEK293, His) is a recombinant human bone marrow stromal antigen 2 produced in HEK293 cells. Bone marrow stromal antigen 2 (BST-2; also known as tetherin or CD317) is an IFN-inducible gene that functions to block the release of a range of nascent enveloped virions from infected host cells[1].

Product Specifications

Product Name Alternative

BST2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bst2-protein-human-hek293-his.html

Purity

95.43

Smiles

NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSHHHHHH

Molecular Formula

684 (Gene_ID) Q10589 (N49-S161) (Accession)

Molecular Weight

20-30 kDa

References & Citations

[1]Mahauad-Fernandez WD, et al. Critical role for bone marrow stromal antigen 2 in acute Chikungunya virus infection. J Gen Virol. 2014;95 (Pt 11) :2450-2461.|[2]Tiwari R, et al. Beyond Tethering the Viral Particles: Immunomodulatory Functions of Tetherin (BST-2) . DNA Cell Biol. 2019;38 (11) :1170-1177.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (Membrane Metalloendopeptidase) (MME/1892), CF640R conjugate, 0.1mg/mL
BNC401892-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1892), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3529), CF647 conjugate, 0.1mg/mL
BNC473529-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3529), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD300LD (NM_001115152) Human Over-expression Lysate
LC426525 20 µg

CD300LD (NM_001115152) Human Over-expression Lysate

Sign In for Pricing
View Details
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2714), CF647 conjugate, 0.1mg/mL
BNC472714-500 1x 500 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2714), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Replacement Cartridge for Label Printers
L9010-12ULT 1 Each

Replacement Cartridge for Label Printers

Sign In for Pricing
View Details
Fascin-1 (FSCN1/417), Biotin conjugate, 0.1mg/mL
BNCB0417-100 1x 100 µL

Fascin-1 (FSCN1/417), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details