Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BST2, Human (HEK293, His)

BST2 Protein, Human (HEK293, His) is a recombinant human bone marrow stromal antigen 2 produced in HEK293 cells. Bone marrow stromal antigen 2 (BST-2; also known as tetherin or CD317) is an IFN-inducible gene that functions to block the release of a range of nascent enveloped virions from infected host cells[1].

Product Specifications

Product Name Alternative

BST2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bst2-protein-human-hek293-his.html

Purity

95.43

Smiles

NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSHHHHHH

Molecular Formula

684 (Gene_ID) Q10589 (N49-S161) (Accession)

Molecular Weight

20-30 kDa

References & Citations

[1]Mahauad-Fernandez WD, et al. Critical role for bone marrow stromal antigen 2 in acute Chikungunya virus infection. J Gen Virol. 2014;95 (Pt 11) :2450-2461.|[2]Tiwari R, et al. Beyond Tethering the Viral Particles: Immunomodulatory Functions of Tetherin (BST-2) . DNA Cell Biol. 2019;38 (11) :1170-1177.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 15 (KRT15) Mouse Monoclonal Antibody [Clone ID: 6E7]
AM06387SU-N 100 µL

Cytokeratin 15 (KRT15) Mouse Monoclonal Antibody [Clone ID: 6E7]

Sign In for Pricing
View Details
Bromocyclobutane
TRC-B685023-250MG 250 mg

Bromocyclobutane

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (SPN/3388), CF594 conjugate, 0.1mg/mL
BNC943388-500 1x 500 µL

CD43 (T-Cell Marker) (SPN/3388), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), Biotin conjugate, 0.1mg/mL
BNCB2748-100 1x 100 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KCTD9 (NM_017634) Human Over-expression Lysate
LC402603 20 µg

KCTD9 (NM_017634) Human Over-expression Lysate

Sign In for Pricing
View Details
MelanA (MLANA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5E6]
TA506051BM 100 µL

MelanA (MLANA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5E6]

Sign In for Pricing
View Details