Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BST2, Human (HEK293, His)

BST2 Protein, Human (HEK293, His) is a recombinant human bone marrow stromal antigen 2 produced in HEK293 cells. Bone marrow stromal antigen 2 (BST-2; also known as tetherin or CD317) is an IFN-inducible gene that functions to block the release of a range of nascent enveloped virions from infected host cells[1].

Product Specifications

Product Name Alternative

BST2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bst2-protein-human-hek293-his.html

Purity

95.43

Smiles

NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSHHHHHH

Molecular Formula

684 (Gene_ID) Q10589 (N49-S161) (Accession)

Molecular Weight

20-30 kDa

References & Citations

[1]Mahauad-Fernandez WD, et al. Critical role for bone marrow stromal antigen 2 in acute Chikungunya virus infection. J Gen Virol. 2014;95 (Pt 11) :2450-2461.|[2]Tiwari R, et al. Beyond Tethering the Viral Particles: Immunomodulatory Functions of Tetherin (BST-2) . DNA Cell Biol. 2019;38 (11) :1170-1177.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLAMF6, CT (SLAMF6, KALI, SLAM family member 6, Activating NK receptor, NK-T-B-antigen, CD352) (FITC)
MBS6347937-01 0.2 mL

SLAMF6, CT (SLAMF6, KALI, SLAM family member 6, Activating NK receptor, NK-T-B-antigen, CD352) (FITC)

Sign In for Pricing
View Details
SLAMF6, CT (SLAMF6, KALI, SLAM family member 6, Activating NK receptor, NK-T-B-antigen, CD352) (FITC)
MBS6347937-02 5x 0.2 mL

SLAMF6, CT (SLAMF6, KALI, SLAM family member 6, Activating NK receptor, NK-T-B-antigen, CD352) (FITC)

Sign In for Pricing
View Details
Duck Phosphopantothenoylcysteine Synthetase (PPCS) ELISA Kit
MBS9399656 Inquire

Duck Phosphopantothenoylcysteine Synthetase (PPCS) ELISA Kit

Sign In for Pricing
View Details
GALNT2 (NM_004481) Human Tagged ORF Clone Lentiviral Particle
RC207893L2V 200 µL

GALNT2 (NM_004481) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
WEE1 (Biotin)
581533-01 50 µg

WEE1 (Biotin)

Sign In for Pricing
View Details
WEE1 (Biotin)
581533-02 100 µg

WEE1 (Biotin)

Sign In for Pricing
View Details