Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxb1 Rabbit Polyclonal Antibody (HRP)

Hoxb1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hox-2., Hox-2.9

UniProt

P17919

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse Hoxb1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QQPPSSLGVSFPSPAPSGYAPAACNPSYGPSQYYSVGQSEGDGSYFHPSS

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_032292

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLGRKT Antibody, Biotin conjugated
A68866-50UG 50 µg

PLGRKT Antibody, Biotin conjugated

Sign In for Pricing
View Details
RIMKLA Recombinant Protein (Human)
RP026455 100 µg

RIMKLA Recombinant Protein (Human)

Sign In for Pricing
View Details
CRABP2 Polyclonal Antibody, Biotin Conjugated
A62333-050 50 µL

CRABP2 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Polyclonal CD38 Antibody (Internal)
APG02496G 0.05mg

Polyclonal CD38 Antibody (Internal)

Sign In for Pricing
View Details
GATA-1 (phospho-S142) polyclonal antibody
BS4840-01 50 µL

GATA-1 (phospho-S142) polyclonal antibody

Sign In for Pricing
View Details
GATA-1 (phospho-S142) polyclonal antibody
BS4840-02 100 µL

GATA-1 (phospho-S142) polyclonal antibody

Sign In for Pricing
View Details