Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB13 Rabbit Polyclonal Antibody (HRP)

HOXB13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P70321

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse HOXB13

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GYFGGGYYSCRVSRSSLKPCAQTAALATYPSETPAPGEEYPSRPTEFAFY

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032293

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Scavenger receptor class B member 1,SCARB1 ELISA KIT
JOT-EK6121Hu-01 96 Well

Human Scavenger receptor class B member 1,SCARB1 ELISA KIT

Sign In for Pricing
View Details
Human Scavenger receptor class B member 1,SCARB1 ELISA KIT
JOT-EK6121Hu-02 48 Well

Human Scavenger receptor class B member 1,SCARB1 ELISA KIT

Sign In for Pricing
View Details
HS1BP3 (NM_022460) Human Recombinant Protein
TP308668M 100 µg

HS1BP3 (NM_022460) Human Recombinant Protein

Sign In for Pricing
View Details
ICA1L Protein Vector (Human) (pPM-C-HA)
PV020667 500 ng

ICA1L Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Direct Bilirubin (D-BIL) kit (chemical oxidation)
BC164 96 Tests

Direct Bilirubin (D-BIL) kit (chemical oxidation)

Sign In for Pricing
View Details
Lentiviral mouse Cbx4 shRNA (UAS) - Lentiviral mouseCbx4 shRNA (UAS, GFP) (25)
GTR15183128 1 Vial

Lentiviral mouse Cbx4 shRNA (UAS) - Lentiviral mouseCbx4 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details