Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxb9 Rabbit Polyclonal Antibody (FITC)

Hoxb9 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Hox-2., Hox-2.5

UniProt

A2A9Z6

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of mouse Hoxb9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYANPRQPGHAEHLDFPSC

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032296

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EnzyChrom™ NADP/NADPH Assay Kit
E2NP-100 100 Tests

EnzyChrom™ NADP/NADPH Assay Kit

Sign In for Pricing
View Details
Sdc2 Mouse Gene Knockout Kit (CRISPR)
KN515419 1 Kit

Sdc2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UBE3C (NM_014671) Human Recombinant Protein
TP315110 20 µg

UBE3C (NM_014671) Human Recombinant Protein

Sign In for Pricing
View Details
Human PHIP activation kit by CRISPRa
GA110460 1 Kit

Human PHIP activation kit by CRISPRa

Sign In for Pricing
View Details
Cytochrome P450 Reductase (CPR) Activity Assay Kit
E-BC-K808-M-01 48 T (32 samples)

Cytochrome P450 Reductase (CPR) Activity Assay Kit

Sign In for Pricing
View Details
Cytochrome P450 Reductase (CPR) Activity Assay Kit
E-BC-K808-M-02 96 T (80 samples)

Cytochrome P450 Reductase (CPR) Activity Assay Kit

Sign In for Pricing
View Details