Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSF1 Rabbit Polyclonal Antibody (FITC)

HSF1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HSTF, HSTF 1, AA960185, Hsf1beta, Hsf1alpha

UniProt

P38532

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse HSF1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AVDTGSSELPVLFELGESSYFSEGDDYTDDPTISLLTGTEPHKAKDPTVS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032322

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rod outer segment membrane protein 1 (ROM1) Mouse ELISA Kit
G8450 96 Tests

Rod outer segment membrane protein 1 (ROM1) Mouse ELISA Kit

Sign In for Pricing
View Details
Anti-Heat Shock Protein 90Kda Alpha B1 (HSP90AB1)
FY-AB47781-01 1 mL

Anti-Heat Shock Protein 90Kda Alpha B1 (HSP90AB1)

Sign In for Pricing
View Details
Anti-Heat Shock Protein 90Kda Alpha B1 (HSP90AB1)
FY-AB47781-02 100 µL

Anti-Heat Shock Protein 90Kda Alpha B1 (HSP90AB1)

Sign In for Pricing
View Details
Anti-Heat Shock Protein 90Kda Alpha B1 (HSP90AB1)
FY-AB47781-03 200 µL

Anti-Heat Shock Protein 90Kda Alpha B1 (HSP90AB1)

Sign In for Pricing
View Details
pExpress-1-Slc45a1 Plasmid
PVT57459 2 µg

pExpress-1-Slc45a1 Plasmid

Sign In for Pricing
View Details
Research Grade Vofatamab
MBS1563634-01 0.1 mg

Research Grade Vofatamab

Sign In for Pricing
View Details