Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSF1 Rabbit Polyclonal Antibody (Biotin)

HSF1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HSTF, HSTF 1, AA960185, Hsf1beta, Hsf1alpha

UniProt

P38532

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse HSF1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AVDTGSSELPVLFELGESSYFSEGDDYTDDPTISLLTGTEPHKAKDPTVS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032322

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

vinculin CRISPR Activation Plasmid (m)
sc-423660-ACT 20 µg

vinculin CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Ndufc1 ORF Vector (Mouse) (pORF)
ORF051175 1.0 µg DNA

Ndufc1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
2610015P09Rik shRNA (m) Lentiviral Particles
sc-108782-V 200 µL

2610015P09Rik shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
CD55 Antibody
GWB-6BE7EF 0.2 mg

CD55 Antibody

Sign In for Pricing
View Details
Krtap4-2 Lentiviral Activation Particles (m)
sc-427137-LAC 200 µL

Krtap4-2 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Bcl10 (B-Cell CLL/Lymphoma 10, CARMEN, CIPER, CLAP, c-E10, mE10, CARD-containing molecule enhancing NF-kappa-B, CED-3/ICH-1 prodomain homologous E10-like regulator, Cellular homolog of vCARMEN)
362263 200 µL

Bcl10 (B-Cell CLL/Lymphoma 10, CARMEN, CIPER, CLAP, c-E10, mE10, CARD-containing molecule enhancing NF-kappa-B, CED-3/ICH-1 prodomain homologous E10-like regulator, Cellular homolog of vCARMEN)

Sign In for Pricing
View Details