Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSF1 Rabbit Polyclonal Antibody (FITC)

HSF1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HSTF, HSTF 1, AA960185, Hsf1beta, Hsf1alpha

UniProt

P38532

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse HSF1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YTAQPLFLLDPDAVDTGSSELPVLFELGESSYFSEGDDYTDDPTISLLTG

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032322

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Legionella Pneumophila rpsC Protein (aa 1-218) (strain Corby)
VAng-Lsx04186-500gEcoli 500 µg (E. coli)

Recombinant Legionella Pneumophila rpsC Protein (aa 1-218) (strain Corby)

Sign In for Pricing
View Details
BOLL Antibody
A14167-100UL 100 µL

BOLL Antibody

Sign In for Pricing
View Details
Pigeon Soluble Cluster of Differentiation 146 (SCD146) ELISA Kit
MBS9901244 Inquire

Pigeon Soluble Cluster of Differentiation 146 (SCD146) ELISA Kit

Sign In for Pricing
View Details
TRAPPC2B (NR_002166) Human Recombinant Protein
E45H35777M5 20 µg

TRAPPC2B (NR_002166) Human Recombinant Protein

Sign In for Pricing
View Details
4,4'-Oxybis (benzenesulfonyl chloride)
FO62672 100 g

4,4'-Oxybis (benzenesulfonyl chloride)

Sign In for Pricing
View Details
Phospho-BRD4-S1083 Rabbit mAb
E45R11563N 50 ul

Phospho-BRD4-S1083 Rabbit mAb

Sign In for Pricing
View Details