Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSF1 Rabbit Polyclonal Antibody (Biotin)

HSF1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HSTF, HSTF 1, AA960185, Hsf1beta, Hsf1alpha

UniProt

P38532

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse HSF1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YTAQPLFLLDPDAVDTGSSELPVLFELGESSYFSEGDDYTDDPTISLLTG

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032322

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus Aureus lytN Protein (aa 50-383) (strain MRSA252)
VAng-Cr5888-500gEcoli 500 µg (E. coli)

Recombinant Staphylococcus Aureus lytN Protein (aa 50-383) (strain MRSA252)

Sign In for Pricing
View Details
WDSUB1 (NM_152528) Human Tagged Lenti ORF Clone
RC212468L4 10 µg

WDSUB1 (NM_152528) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human CA125 ELISA Kit
EHC0480 96 Tests

Human CA125 ELISA Kit

Sign In for Pricing
View Details
PROKR2 3'UTR Lenti-reporter-Luc Vector
37735081 1.0 µg

PROKR2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
DFNA41 sgRNA CRISPR Lentivector set (Human)
K0588101 3x 1.0 µg

DFNA41 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
FEM1C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0773908 1.0 µg DNA

FEM1C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details