Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klf2 Rabbit Polyclonal Antibody (FITC)

Klf2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Lk, Lklf

UniProt

Q60843

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MALSEPILPSFATFASPCERGLQERWPRNEPEAGGTDEDLNNVLDFILSM

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_032478

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COP9 Signalosome complex subunit 4 (COPS4) Porcine ELISA Kit
C5763 96 Tests

COP9 Signalosome complex subunit 4 (COPS4) Porcine ELISA Kit

Sign In for Pricing
View Details
IGF1 antibody
10R-I107A 0.2 mg

IGF1 antibody

Sign In for Pricing
View Details
Lentiviral mouse Spata2l shRNA (UAS) - Lentiviral mouse Spata2l shRNA (UAS, RFP) (100)
GTR15237864 1 Vial

Lentiviral mouse Spata2l shRNA (UAS) - Lentiviral mouse Spata2l shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
10 μl; stacked pipette tip
DZPXT-10 96 pcs/layer, 10 layers/stack, 10 pcs/box

10 μl; stacked pipette tip

Sign In for Pricing
View Details
IFI16/p16 (Interferon-inducible Protein 16) BioAssayTM ELISA Kit (Mouse) discontinued
356458-01 48 Tests

IFI16/p16 (Interferon-inducible Protein 16) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
IFI16/p16 (Interferon-inducible Protein 16) BioAssayTM ELISA Kit (Mouse) discontinued
356458-02 96 Tests

IFI16/p16 (Interferon-inducible Protein 16) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details