Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxc1 Rabbit Polyclonal Antibody (FITC)

Foxc1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ch, Mf1, Mf4, FREA, Fkh1, frkh, fkh-1, FREAC3, frkhda

UniProt

Q9QWR9

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of mouse Foxc1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHP

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032618

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peroxiredoxin 1 Rabbit pAb, Pacific Blue conjugated
orb2842749 100 µL

Peroxiredoxin 1 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
CD49f (Integrin Alpha 6 Chain, VLA-6) (MaxLight 405) discontinued
214708-ML405 100 µL

CD49f (Integrin Alpha 6 Chain, VLA-6) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Human UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
MBS1123899-01 0.02 mg (Yeast)

Recombinant Human UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit

Sign In for Pricing
View Details
Recombinant Human UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
MBS1123899-02 0.1 mg (Yeast)

Recombinant Human UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit

Sign In for Pricing
View Details
Recombinant Human UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
MBS1123899-03 1 mg (Yeast)

Recombinant Human UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit

Sign In for Pricing
View Details
Recombinant Human UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
MBS1123899-04 5x 1 mg (Yeast)

Recombinant Human UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit

Sign In for Pricing
View Details