Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxd2 Rabbit Polyclonal Antibody (HRP)

Foxd2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Mf2, AI426778

UniProt

O35392

Immunogen

The immunogen is a synthetic peptide directed towards the c terminal region of mouse Foxd2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GPGGQAQVLAMLTAPALTPVAGHIRLSHPGDSLLSSGPSFASKVAGLSGC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_032619

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF554 Polyclonal Antibody, FITC Conjugated
A63938-100 100 µL

ZNF554 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
CCL23 Rabbit Polyclonal Antibody
E53P09594 100 µL

CCL23 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Rhizobium leguminosarum bv. viciae Anthranilate phosphoribosyltransferase (trpD)
MBS1364885-01 0.02 mg (E-Coli)

Recombinant Rhizobium leguminosarum bv. viciae Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details
Recombinant Rhizobium leguminosarum bv. viciae Anthranilate phosphoribosyltransferase (trpD)
MBS1364885-02 0.02 mg (Yeast)

Recombinant Rhizobium leguminosarum bv. viciae Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details
Recombinant Rhizobium leguminosarum bv. viciae Anthranilate phosphoribosyltransferase (trpD)
MBS1364885-03 0.1 mg (E-Coli)

Recombinant Rhizobium leguminosarum bv. viciae Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details
Recombinant Rhizobium leguminosarum bv. viciae Anthranilate phosphoribosyltransferase (trpD)
MBS1364885-04 0.1 mg (Yeast)

Recombinant Rhizobium leguminosarum bv. viciae Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details