Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nab2 Rabbit Polyclonal Antibody (HRP)

Nab2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI451907

UniProt

Q61127

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Nab2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APPYRPSLEEDSASLSGESLDGHLQAVGSCPRLTPPPADLPLALPAHGLW

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032694

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MIA-2
P7203-100μg 100 µg

Recombinant Human MIA-2

Sign In for Pricing
View Details
Chloramphenicol  C  50 mcg
SD131-5CT 1 unit

Chloramphenicol C 50 mcg

Sign In for Pricing
View Details
Bovine FUNDC1 / FUN14 domain-containing protein 1 ELISA Kit
MBS2906330-01 48 Well

Bovine FUNDC1 / FUN14 domain-containing protein 1 ELISA Kit

Sign In for Pricing
View Details
Bovine FUNDC1 / FUN14 domain-containing protein 1 ELISA Kit
MBS2906330-02 96 Well

Bovine FUNDC1 / FUN14 domain-containing protein 1 ELISA Kit

Sign In for Pricing
View Details
Bovine FUNDC1 / FUN14 domain-containing protein 1 ELISA Kit
MBS2906330-03 5x 96 Well

Bovine FUNDC1 / FUN14 domain-containing protein 1 ELISA Kit

Sign In for Pricing
View Details
Bovine FUNDC1 / FUN14 domain-containing protein 1 ELISA Kit
MBS2906330-04 10x 96 Well

Bovine FUNDC1 / FUN14 domain-containing protein 1 ELISA Kit

Sign In for Pricing
View Details