Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKX2-3 Rabbit Polyclonal Antibody (HRP)

NKX2-3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ti, Nkx2., Nkx-2., Nkx2.3, nkx2-C, tinman, Nkx-2.3

UniProt

P97334

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse NKX2-3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GTHAPPPPPRRVAVPVLVRDGKPCVTPSAQTYGSPYGVGAGAYSYNSFPA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_032725

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP2A7, ID (CYP2A7, Cytochrome P450 2A7, CYPIIA7, Cytochrome P450 IIA4) (MaxLight 550)
MBS6290481-01 0.1 mL

CYP2A7, ID (CYP2A7, Cytochrome P450 2A7, CYPIIA7, Cytochrome P450 IIA4) (MaxLight 550)

Sign In for Pricing
View Details
CYP2A7, ID (CYP2A7, Cytochrome P450 2A7, CYPIIA7, Cytochrome P450 IIA4) (MaxLight 550)
MBS6290481-02 5x 0.1 mL

CYP2A7, ID (CYP2A7, Cytochrome P450 2A7, CYPIIA7, Cytochrome P450 IIA4) (MaxLight 550)

Sign In for Pricing
View Details
PPP1CB Polyclonal Antibody
RD75324A-01 20 µL

PPP1CB Polyclonal Antibody

Sign In for Pricing
View Details
PPP1CB Polyclonal Antibody
RD75324A-02 60 μL

PPP1CB Polyclonal Antibody

Sign In for Pricing
View Details
PPP1CB Polyclonal Antibody
RD75324A-03 120 μL

PPP1CB Polyclonal Antibody

Sign In for Pricing
View Details
PPP1CB Polyclonal Antibody
RD75324A-04 200 µL

PPP1CB Polyclonal Antibody

Sign In for Pricing
View Details