Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKX2-3 Rabbit Polyclonal Antibody (HRP)

NKX2-3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ti, Nkx2., Nkx-2., Nkx2.3, nkx2-C, tinman, Nkx-2.3

UniProt

P97334

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse NKX2-3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GTHAPPPPPRRVAVPVLVRDGKPCVTPSAQTYGSPYGVGAGAYSYNSFPA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_032725

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNT8A (Wingless-type MMTV Integration Site Family Member 8A, Protein Wnt-8a, Protein Wnt-8d, WNT8D)
135406 50 µg

WNT8A (Wingless-type MMTV Integration Site Family Member 8A, Protein Wnt-8a, Protein Wnt-8d, WNT8D)

Sign In for Pricing
View Details
Goat Polyclonal RPS19 Antibody
NB100-2452 0.1 mg

Goat Polyclonal RPS19 Antibody

Sign In for Pricing
View Details
PEX26 AAV Vector (Human) (CMV)
36414102 1 µg

PEX26 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
FUT4 Rabbit Polyclonal Antibody (Biotin)
orb2081725 100 µL

FUT4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
BCL-Rambo / BCL2-like 13 / MIL1 Protein (BCL2L13) Rabbit anti-Human Polyclonal (Internal) Antibody
GWB-119170 0.05 mg

BCL-Rambo / BCL2-like 13 / MIL1 Protein (BCL2L13) Rabbit anti-Human Polyclonal (Internal) Antibody

Sign In for Pricing
View Details
Jph2 CRISPR Knock Out 293T Cell Line (Human)
25258141 1x 10^6 Cells / 1.0 mL

Jph2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details