Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pgr Rabbit Polyclonal Antibody (FITC)

Pgr Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P, PR, NR3, PR-A, PR-B, NR3C3, BB114106, 9930019P03Rik

UniProt

A6H6A5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Pgr

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SGSAHWPGAGVKPSPQPAAGEVEEDSGLETEGSAAPLLKSKPRALEGTGS

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

99

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_032855

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSH6 (DNA Mismatch Repair Protein) (MSH6/3086), Biotin conjugate, 0.1mg/mL
BNCB3086-100 1x 100 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/3086), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Freeze Dryer BFFT-317-A
BFFT-317-A 1 Unit

Freeze Dryer BFFT-317-A

Sign In for Pricing
View Details
Cytochrome C (Mitochondrial Marker) (CYCS/3128R), CF740 conjugate, 0.1mg/mL
BNC743128-500 1x 500 µL

Cytochrome C (Mitochondrial Marker) (CYCS/3128R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP1 (Colorectal Cancer Biomarker / Marker of Lymph Node Metastasis) (rTIMP1/1710), 1mg/mL
BNUM1943-50 1x 50 µL

TIMP1 (Colorectal Cancer Biomarker / Marker of Lymph Node Metastasis) (rTIMP1/1710), 1mg/mL

Sign In for Pricing
View Details
Mouse PAI1 Antibody Pair Set
E-KAB-0604 50 µL & 100 µg

Mouse PAI1 Antibody Pair Set

Sign In for Pricing
View Details
CD79a (HM47/A9), Biotin conjugate, 0.1mg/mL
BNCB0477-500 1x 500 µL

CD79a (HM47/A9), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details