Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rel Rabbit Polyclonal Antibody (HRP)

Rel Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C-R, c-Rel

UniProt

A4QPD3

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KAILEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIF

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033070

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cholesterol 5Alpha,6Alpha-Epoxide
TRC-C432528-25MG 25 mg

Cholesterol 5Alpha,6Alpha-Epoxide

Sign In for Pricing
View Details
FBXO39 (C-term) Rabbit Polyclonal Antibody
AP51630PU-N 400 µL

FBXO39 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KIST (UHMK1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D3]
TA501719BM 100 µL

KIST (UHMK1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D3]

Sign In for Pricing
View Details
Tide Quencher™ 6WS azide [TQ6WS azide]
2097-AAT 1 mg

Tide Quencher™ 6WS azide [TQ6WS azide]

Sign In for Pricing
View Details
CD4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E2]
TA802199BM 100 µL

CD4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E2]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse IgD Antibody[11-26c.2a]
E-AB-F1189UH-01 25 µg

PE/Cyanine7 Anti-Mouse IgD Antibody[11-26c.2a]

Sign In for Pricing
View Details