Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RELB Rabbit Polyclonal Antibody (HRP)

RELB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sh, shep

UniProt

Q04863

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse RELB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGLPDVLGELSSSDPHG

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033072

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PELI3 Rabbit Polyclonal Antibody
orb312733-01 50 μL

PELI3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PELI3 Rabbit Polyclonal Antibody
orb312733-02 100 µL

PELI3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PELI3 Rabbit Polyclonal Antibody
orb312733-03 200 µL

PELI3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Gel-Out Concentrator
023-250C 250 Isolations

Gel-Out Concentrator

Sign In for Pricing
View Details
Anti-Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)
FY-AB46244-01 1 mL

Anti-Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)

Sign In for Pricing
View Details
Anti-Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)
FY-AB46244-02 100 µL

Anti-Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)

Sign In for Pricing
View Details