Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RELB Rabbit Polyclonal Antibody (Biotin)

RELB Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Sh, shep

UniProt

Q04863

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse RELB

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGLPDVLGELSSSDPHG

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033072

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSH2 CRISPR Activation Plasmid (h)
sc-400966-ACT 20 µg

MSH2 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Anti-RNF34 Antibody Picoband® Fluoro647 Conjugated
A08108-2-Fluoro647 100 µg/Vial

Anti-RNF34 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Recombinant Human Signal Transducer And Activator Of Transcription 3 (STAT3)
RPU51946-01 50 µg

Recombinant Human Signal Transducer And Activator Of Transcription 3 (STAT3)

Sign In for Pricing
View Details
Recombinant Human Signal Transducer And Activator Of Transcription 3 (STAT3)
RPU51946-02 100 µg

Recombinant Human Signal Transducer And Activator Of Transcription 3 (STAT3)

Sign In for Pricing
View Details
Recombinant Human Signal Transducer And Activator Of Transcription 3 (STAT3)
RPU51946-03 1 mg

Recombinant Human Signal Transducer And Activator Of Transcription 3 (STAT3)

Sign In for Pricing
View Details
KIZ Antibody
MBS7045267-01 0.05 mL

KIZ Antibody

Sign In for Pricing
View Details