Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrx2 Rabbit Polyclonal Antibody (FITC)

Prrx2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

S, Pr, S8, Prx2

UniProt

Q06348

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DPPAPGPGPPPAPGDCAQARKNFSVSHLLDLEEVAAAGRRAAGPVSGPAE

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_033142

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eppendorf Centrifuge bundle 5702R- IVD Only
E5703000462 1 Each

Eppendorf Centrifuge bundle 5702R- IVD Only

Sign In for Pricing
View Details
Anti-eNOS/NOS3 Antibody Picoband®, PE Conjugate
A01604-3-PE 100 µg/Vial

Anti-eNOS/NOS3 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
Human PLCB1 Pre-designed siRNA Set B
SI012304B 1 Each

Human PLCB1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
IC Cation Std Potassium 1000ppm in 0.005% HNO3
ICCS03 100 mL

IC Cation Std Potassium 1000ppm in 0.005% HNO3

Sign In for Pricing
View Details
Rab23 3'UTR Luciferase Stable Cell Line
TU217185 1.0 mL

Rab23 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rhesus macaque CD4 Protein, His-Avi Tag (Biotin)
orb1496297-01 200 µg

Rhesus macaque CD4 Protein, His-Avi Tag (Biotin)

Sign In for Pricing
View Details