Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrx2 Rabbit Polyclonal Antibody (HRP)

Prrx2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S, Pr, S8, Prx2

UniProt

Q06348

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DPPAPGPGPPPAPGDCAQARKNFSVSHLLDLEEVAAAGRRAAGPVSGPAE

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_033142

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human NMUR2 shRNA (UAS) - Lentiviral human NMUR2 shRNA (UAS, GFP) (25)
GTR15326339 1 Vial

Lentiviral human NMUR2 shRNA (UAS) - Lentiviral human NMUR2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
AKR1B10 Antibody (IHC Gold)
E36PA508 100 µL

AKR1B10 Antibody (IHC Gold)

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae GINS3 Protein (aa 1-194) [His]
VAng-Wyb4696-1mg 1 mg

Recombinant Saccharomyces Cerevisiae GINS3 Protein (aa 1-194) [His]

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Mouse IgG (H+L) Secondary Antibody [DyLight 650]
NB7535C 1 mL

Goat Polyclonal Goat anti-Mouse IgG (H+L) Secondary Antibody [DyLight 650]

Sign In for Pricing
View Details
Recombinant E.coli Aquaporin Z Protein, His, Invitro-E.coli-100ug
QP9963-iv-100ug 100ug

Recombinant E.coli Aquaporin Z Protein, His, Invitro-E.coli-100ug

Sign In for Pricing
View Details
CTSS Antibody
K29028U14G07C-01 50 ug

CTSS Antibody

Sign In for Pricing
View Details