Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stat1 Rabbit Polyclonal Antibody (HRP)

Stat1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DD6G4-4

UniProt

Q9QXK0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Stat1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DQVMCIEHEIKTLEDLQDEYDFKCKTSQNRESEANGVAKSDQKQEQLLLH

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_116001

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIN1, ID (PIN1, Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1, Peptidyl-prolyl cis-trans isomerase Pin1, Rotamase Pin1) (APC) discontinued
040065-APC 200 µL

PIN1, ID (PIN1, Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1, Peptidyl-prolyl cis-trans isomerase Pin1, Rotamase Pin1) (APC) discontinued

Sign In for Pricing
View Details
OR6B2, CT (OR6B2, OR6B2P, Olfactory receptor 6B2, Olfactory receptor OR2-1) (FITC)
MBS6329309-01 0.2 mL

OR6B2, CT (OR6B2, OR6B2P, Olfactory receptor 6B2, Olfactory receptor OR2-1) (FITC)

Sign In for Pricing
View Details
OR6B2, CT (OR6B2, OR6B2P, Olfactory receptor 6B2, Olfactory receptor OR2-1) (FITC)
MBS6329309-02 5x 0.2 mL

OR6B2, CT (OR6B2, OR6B2P, Olfactory receptor 6B2, Olfactory receptor OR2-1) (FITC)

Sign In for Pricing
View Details
Lentiviral mouse Map3k14 shRNA (UAS) - Lentiviral mouse Map3k14 shRNA (UAS, GFP) (100)
GTR15293184 1 Vial

Lentiviral mouse Map3k14 shRNA (UAS) - Lentiviral mouse Map3k14 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Cuta 3'UTR GFP Stable Cell Line
TU154560 1.0 mL

Cuta 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Hydroxyproline (Hyp) ELISA Kit
YP-W99933-01 48 Tests

Hydroxyproline (Hyp) ELISA Kit

Sign In for Pricing
View Details