Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tal2 Rabbit Polyclonal Antibody (HRP)

Tal2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BHLHa, bHLHa19

UniProt

Q62282

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: INFLVKVLGEQSLHQTGVAAQGNILGLFPPKTRLPDEDDRTLLNDYRVPS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033343

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHMP1A, NT (CHMP1A, CHMP1, KIAA0047, PCOLN3, PRSM1, Charged multivesicular body protein 1a, Chromatin-modifying protein 1a, Vacuolar protein sorting-associated protein 46-1) (MaxLight 490)
MBS6285662-01 0.1 mL

CHMP1A, NT (CHMP1A, CHMP1, KIAA0047, PCOLN3, PRSM1, Charged multivesicular body protein 1a, Chromatin-modifying protein 1a, Vacuolar protein sorting-associated protein 46-1) (MaxLight 490)

Sign In for Pricing
View Details
CHMP1A, NT (CHMP1A, CHMP1, KIAA0047, PCOLN3, PRSM1, Charged multivesicular body protein 1a, Chromatin-modifying protein 1a, Vacuolar protein sorting-associated protein 46-1) (MaxLight 490)
MBS6285662-02 5x 0.1 mL

CHMP1A, NT (CHMP1A, CHMP1, KIAA0047, PCOLN3, PRSM1, Charged multivesicular body protein 1a, Chromatin-modifying protein 1a, Vacuolar protein sorting-associated protein 46-1) (MaxLight 490)

Sign In for Pricing
View Details
CD44 Knockout A2780 Polyclonal Cells
ARG43580 1 Million

CD44 Knockout A2780 Polyclonal Cells

Sign In for Pricing
View Details
IGSF9 Rabbit Polyclonal Antibody (BF594)
orb1574119 100 µL

IGSF9 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Anti-Neutrophil Elastase  (3E5)
YF-MA12813 50 ug

Anti-Neutrophil Elastase (3E5)

Sign In for Pricing
View Details
SULT1A1 Protein Lysate
OCOA04803-20UG 20 µg

SULT1A1 Protein Lysate

Sign In for Pricing
View Details