Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOB1 Rabbit Polyclonal Antibody (Biotin)

TOB1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

To, Tr, Tob, Trob

UniProt

Q640M3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse TOB1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QPLTFTTATFAATKFGSTKMKNSGRSSKVARTSPINLGLTVNVNDLLKQK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_033453

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTRHD1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-4433R-BF750 100 µL

PTRHD1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
TIGD4 Polyclonal Antibody, Biotin Conjugated
A66177-050 50 µL

TIGD4 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
NOTO sgRNA CRISPR Lentivector (Human) (Target 1)
K1442502 1.0 µg DNA

NOTO sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rabbit Porcine L-Lactic dehydrogenase LDH-1 (M4) isozyme Antibody
orb21077 10 mg

Rabbit Porcine L-Lactic dehydrogenase LDH-1 (M4) isozyme Antibody

Sign In for Pricing
View Details
Depdc7 (NM_144804) Mouse Tagged Lenti ORF Clone
MR208218L3 10 µg

Depdc7 (NM_144804) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GPR50 Polyclonal Antibody
E20-72024 100 µg

GPR50 Polyclonal Antibody

Sign In for Pricing
View Details