Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFY1 Rabbit Polyclonal Antibody (HRP)

ZFY1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Zfy2, Zfy-1

UniProt

P10925

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse ZFY1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EQQMDVSEIKAAFLPIAWTAAYDNNSDEIEDQNVTASALLNQDESGGLDR

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

86kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse

Tested Applications

WB

NCBI Accession Number

NP_033596

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Olfactory receptor 4C16 (OR4C16) ELISA Kit
MBS7238911-01 48 Well

Canine Olfactory receptor 4C16 (OR4C16) ELISA Kit

Sign In for Pricing
View Details
Canine Olfactory receptor 4C16 (OR4C16) ELISA Kit
MBS7238911-02 96 Well

Canine Olfactory receptor 4C16 (OR4C16) ELISA Kit

Sign In for Pricing
View Details
Canine Olfactory receptor 4C16 (OR4C16) ELISA Kit
MBS7238911-03 5x 96 Well

Canine Olfactory receptor 4C16 (OR4C16) ELISA Kit

Sign In for Pricing
View Details
Canine Olfactory receptor 4C16 (OR4C16) ELISA Kit
MBS7238911-04 10x 96 Well

Canine Olfactory receptor 4C16 (OR4C16) ELISA Kit

Sign In for Pricing
View Details
Chicken Interleukin 4 (IL-4) ELISA Kit
orb2810388-01 48 Tests

Chicken Interleukin 4 (IL-4) ELISA Kit

Sign In for Pricing
View Details
Chicken Interleukin 4 (IL-4) ELISA Kit
orb2810388-02 96 Tests

Chicken Interleukin 4 (IL-4) ELISA Kit

Sign In for Pricing
View Details