Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APEX1 Rabbit Polyclonal Antibody (Biotin)

APEX1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HA, APE, Apex, HAP1, Ref-, Ref-1

UniProt

Q544Z7

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MPKRGKKAAADDGEEPKSEPETKKSKGAAKKTEKEAAGEGPVLYEDPPDQ

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033817

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC/iFluor® 750 Anti-human CD180 Antibody *G28-8*
118001F2-AAT 500 Tests

APC/iFluor® 750 Anti-human CD180 Antibody *G28-8*

Sign In for Pricing
View Details
EPLIN (LIMA1) Mouse Monoclonal Antibody [Clone ID: OTI7H8]
TA808587S 30 µL

EPLIN (LIMA1) Mouse Monoclonal Antibody [Clone ID: OTI7H8]

Sign In for Pricing
View Details
Phosphate Buffer 0.5M, pH 7.6
41620129-2 500 mL

Phosphate Buffer 0.5M, pH 7.6

Sign In for Pricing
View Details
Acaa1b Protein Vector (Mouse) (pPB-N-His)
PV151523 500 ng

Acaa1b Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Alpha Internexin Rabbit mAb
59668 50 µL

Alpha Internexin Rabbit mAb

Sign In for Pricing
View Details
Recombinant Thermoanaerobacter tengcongensis Serine--tRNA ligase (serS)
MBS1433814-01 0.05 mg (E-Coli)

Recombinant Thermoanaerobacter tengcongensis Serine--tRNA ligase (serS)

Sign In for Pricing
View Details