Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APEX1 Rabbit Polyclonal Antibody (HRP)

APEX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HA, APE, Apex, HAP1, Ref-, Ref-1

UniProt

Q544Z7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse APEX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ETKKSKGAAKKTEKEAAGEGPVLYEDPPDQKTSPSGKSATLKICSWNVDG

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033817

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREPT Polyclonal Antibody, Cy5.5 Conjugated
bs-9971R-Cy5.5 100 µL

CREPT Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
ZNF488 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV705689 1.0 µg DNA

ZNF488 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
THOC2 3'UTR Lenti-reporter-Luc Vector
46658081 1.0 µg

THOC2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Dkk3 (NM_138519) Rat Tagged Lenti ORF Clone
RR203387L3 10 µg

Dkk3 (NM_138519) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Bovine DNA-directed RNA polymerases I, II, and III subunit RPABC4, POLR2K ELISA Kit
MBS9335999-01 48 Well

Bovine DNA-directed RNA polymerases I, II, and III subunit RPABC4, POLR2K ELISA Kit

Sign In for Pricing
View Details
Bovine DNA-directed RNA polymerases I, II, and III subunit RPABC4, POLR2K ELISA Kit
MBS9335999-02 96 Well

Bovine DNA-directed RNA polymerases I, II, and III subunit RPABC4, POLR2K ELISA Kit

Sign In for Pricing
View Details