Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APEX1 Rabbit Polyclonal Antibody (HRP)

APEX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HA, APE, Apex, HAP1, Ref-, Ref-1

UniProt

Q544Z7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse APEX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ETKKSKGAAKKTEKEAAGEGPVLYEDPPDQKTSPSGKSATLKICSWNVDG

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033817

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BOLA1, Recombinant, Human, aa21-137, His-Tag (BolA-like protein 1)
349733-01 100 µg

BOLA1, Recombinant, Human, aa21-137, His-Tag (BolA-like protein 1)

Sign In for Pricing
View Details
BOLA1, Recombinant, Human, aa21-137, His-Tag (BolA-like protein 1)
349733-02 500 µg

BOLA1, Recombinant, Human, aa21-137, His-Tag (BolA-like protein 1)

Sign In for Pricing
View Details
Mouse Monoclonal MST1/STK4 Antibody (01) [Biotin]
NBP3-06376B 0.1 mL

Mouse Monoclonal MST1/STK4 Antibody (01) [Biotin]

Sign In for Pricing
View Details
IFluor® 700 Anti-human CD3 Antibody *HIT3a*
100300J1-AAT 500 Tests

IFluor® 700 Anti-human CD3 Antibody *HIT3a*

Sign In for Pricing
View Details
BLNK Recombinant Protein
OPCD01651-200UG 200 µg

BLNK Recombinant Protein

Sign In for Pricing
View Details
DISP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV709326 1.0 µg DNA

DISP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details