Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APEX1 Rabbit Polyclonal Antibody (Biotin)

APEX1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HA, APE, Apex, HAP1, Ref-, Ref-1

UniProt

Q544Z7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse APEX1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ETKKSKGAAKKTEKEAAGEGPVLYEDPPDQKTSPSGKSATLKICSWNVDG

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033817

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIGX Recombinant Protein Antigen
NBP1-83647PEP 0.1 mL

PIGX Recombinant Protein Antigen

Sign In for Pricing
View Details
RNU7-9P ORF Vector (Human) (pORF)
40606011 1.0 µg DNA

RNU7-9P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
EZH1 Adenovirus (Rat)
19600056 1.0 mL

EZH1 Adenovirus (Rat)

Sign In for Pricing
View Details
Recombinant Mouse FPGS Protein, His (Fc)-Avi-tagged
FPGS-3345M 50 µg

Recombinant Mouse FPGS Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
GM-CSF Antibody (Biotin)
orb1216680 50 µg

GM-CSF Antibody (Biotin)

Sign In for Pricing
View Details
MyoGEF (PLEKHG6) (NM_001144857) Human Tagged Lenti ORF Clone
RC227365L4 10 µg

MyoGEF (PLEKHG6) (NM_001144857) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details