Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMYD1 Rabbit Polyclonal Antibody (FITC)

SMYD1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

B, Bop, C78565, Zmynd18, 4632404M21Rik

UniProt

P97443

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse SMYD1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MENVEVFTSEGKGRGLKATKEFWAADVIFAERAYSAVVFDSLINFVCHTC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033892

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SETBP1 Antibody, HRP conjugated
A72320-50UG 50 µg

SETBP1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Crem Mouse Pre-designed siRNA Set A
HY-RS20710 1 Set

Crem Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral human ACKR2 shRNA (UAS) - Lentiviral human ACKR2 shRNA (UAS, iRFP) plasmid
GTR15313027 1 Vial

Lentiviral human ACKR2 shRNA (UAS) - Lentiviral human ACKR2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
SERPINF2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
43503064 1.0 µg DNA

SERPINF2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
GNAL (NM_001142339) Human Over-expression Lysate
LY428044 100 µg

GNAL (NM_001142339) Human Over-expression Lysate

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Thrombomodulin (TM)
MBS2043459-01 0.1 mL

FITC-Linked Polyclonal Antibody to Thrombomodulin (TM)

Sign In for Pricing
View Details