Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMYD1 Rabbit Polyclonal Antibody (HRP)

SMYD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B, Bop, C78565, Zmynd18, 4632404M21Rik

UniProt

P97443

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse SMYD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MENVEVFTSEGKGRGLKATKEFWAADVIFAERAYSAVVFDSLINFVCHTC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033892

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POP4 siRNA (Rat)
CRR4238-01 15 nmol

POP4 siRNA (Rat)

Sign In for Pricing
View Details
POP4 siRNA (Rat)
CRR4238-02 30 nmol

POP4 siRNA (Rat)

Sign In for Pricing
View Details
XFD700 Anti-human CD8 Antibody *OKT-8*
100821A1-AAT 500 Tests

XFD700 Anti-human CD8 Antibody *OKT-8*

Sign In for Pricing
View Details
OR4S1 siRNA Oligos set (Human)
35261171 3x 5 nmol

OR4S1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
C22orf32 Rabbit Polyclonal Antibody (HRP)
orb1599662 100 µL

C22orf32 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Biotinylated PD-1 His&Avi Tag Protein, Cynomolgus
UA010811-01 25 µg

Biotinylated PD-1 His&Avi Tag Protein, Cynomolgus

Sign In for Pricing
View Details