Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMYD1 Rabbit Polyclonal Antibody (HRP)

SMYD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B, Bop, C78565, Zmynd18, 4632404M21Rik

UniProt

P97443

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse SMYD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MENVEVFTSEGKGRGLKATKEFWAADVIFAERAYSAVVFDSLINFVCHTC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033892

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CE037, CT (POC5, C5orf37, Centrosomal protein POC5, Protein of centriole 5) (APC) discontinued
033738-APC 200 µL

CE037, CT (POC5, C5orf37, Centrosomal protein POC5, Protein of centriole 5) (APC) discontinued

Sign In for Pricing
View Details
Human T-Cell Immunoreceptor With Ig And ITIM Domains Protein (TIGIT) ELISA Kit
EKU08370 96 Tests

Human T-Cell Immunoreceptor With Ig And ITIM Domains Protein (TIGIT) ELISA Kit

Sign In for Pricing
View Details
GLB1L3 Rabbit pAb (APR21507N)
APR21507N-01 50 µL

GLB1L3 Rabbit pAb (APR21507N)

Sign In for Pricing
View Details
GLB1L3 Rabbit pAb (APR21507N)
APR21507N-02 100 µL

GLB1L3 Rabbit pAb (APR21507N)

Sign In for Pricing
View Details
GLB1L3 Rabbit pAb (APR21507N)
APR21507N-03 200 µL

GLB1L3 Rabbit pAb (APR21507N)

Sign In for Pricing
View Details
KMT2B Rabbit pAb
MBS9143514-01 0.02 mL

KMT2B Rabbit pAb

Sign In for Pricing
View Details